SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag

Attribute:

SKU : RCOV02

Categories : Boster Bio (USA)

Share

SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag
SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only.

Product Info Summary

SKU:RCOV02
Size:100μg/vial
Origin Species:Mouse
Source:E. coli


Product Name
SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag

SKU/Catalog Number
RCOV02

Size
100μg/vial

Form
Lyophilized

Description
SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag is produced in E. coli and the theoretical molecular weight is 22.7KD. This product is for research use only. Product is under validation for additional applications and indications. If you're interested, please contact support@bosterbio.com.

Storage & Handling
The product is shipped at ambient temperature. Upon receipt, store it immediately at -20˚C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Cite This Product
SARS-CoV-2 (COVID-19) NSP8 Protein, His Tag (Boster Biological Technology, Pleasanton CA, USA, Catalog # RCOV02)

Formulation
Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose

Predicted MW
22.7KD

Endotoxin
Less than 1 EU/μg protein as determined by LAL method

Expression Form
In supernatant

Amino Acid Sequence
6×His tag at C-terminal
Accession #: YP_009725304 AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQBackground
Coronaviruses (CoV) are a family of large and enveloped positive-sense single-stranded RNA viruses that are classified into four genera, the alpha, beta, gamma, and delta coronaviruses. While gamma and delta coronaviruses mainly infect birds, alpha and beta coronaviruses are known to infect mammals and cause human respiratory illnesses such as the common cold, pneumonia, and severe diseases like SARS, MERS, and COVID-19. Coronavirus nucleoproteins localize to the cytoplasm and the nucleolus, a subnuclear structure, in both virus-infected primary cells and in cells transfected with plasmids that express N protein. Coronavirus N protein is required for coronavirus RNA synthesis, and has RNA chaperone activity that may be involved in template switch. Nucleocapsid protein is the most abundant protein of coronavirus. During virion assembly, the N protein binds to viral RNA and leads to the formation of the helical nucleocapsid. Nucleocapsid protein is a highly immunogenic phosphoprotein also implicated in viral genome replication and in modulating cell signaling pathways. Because of the conservation of N protein sequence and its strong immunogenicity, the N protein of coronavirus is chosen as a diagnostic tool.

 

https://www.bosterbio.com/catalog/product/view/id/93161/s/sars-cov-2-covid-19-nsp8-protein-his-tag

This website uses cookies for best user experience, to find out more you can go to our Privacy Policy  and  Cookies Policy